Lineage for d1xxfa_ (1xxf A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 561786Protein Coagulation factor XI [117237] (1 species)
  7. 561787Species Human (Homo sapiens) [TaxId:9606] [117238] (3 PDB entries)
  8. 561790Domain d1xxfa_: 1xxf A: [116159]
    Other proteins in same PDB: d1xxfc_, d1xxfd_

Details for d1xxfa_

PDB Entry: 1xxf (more details), 2.6 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotin mutant (ecotinp)

SCOP Domain Sequences for d1xxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxfa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens)}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOP Domain Coordinates for d1xxfa_:

Click to download the PDB-style file with coordinates for d1xxfa_.
(The format of our PDB-style files is described here.)

Timeline for d1xxfa_: