Lineage for d1xxfa_ (1xxf A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Coagulation factor XI [117237] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [117238] (58 PDB entries)
    Uniprot P03951 388-624
  8. Domain d1xxfa_: 1xxf A: [116159]
    Other proteins in same PDB: d1xxfc_, d1xxfd_
    complexed with na; mutant

Details for d1xxfa_

PDB Entry: 1xxf (more details), 2.6 Å

PDB Description: Crystal Structure of the FXIa Catalytic Domain in Complex with Ecotin Mutant (EcotinP)
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1xxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxfa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1xxfa_ are not available.

Timeline for d1xxfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xxfb_, d1xxfc_, d1xxfd_