Lineage for d1xxea1 (1xxe A:3-127)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598427Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 598428Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 598429Species Aquifex aeolicus [TaxId:63363] [89829] (2 PDB entries)
  8. 598434Domain d1xxea1: 1xxe A:3-127 [116157]

Details for d1xxea1

PDB Entry: 1xxe (more details)

PDB Description: rdc refined solution structure of the aalpxc/tu-514 complex

SCOP Domain Sequences for d1xxea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxea1 d.14.1.7 (A:3-127) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus}
lektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstdl
gfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnreid
yfvve

SCOP Domain Coordinates for d1xxea1:

Click to download the PDB-style file with coordinates for d1xxea1.
(The format of our PDB-style files is described here.)

Timeline for d1xxea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xxea2