SCOPe 2.07: Domain d1xxdd_: 1xxd D:

Lineage for d1xxdd_ (1xxd D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1xxdd_: 1xxd D: [116156]
   Other proteins in same PDB: d1xxda_, d1xxdb_

Details for d1xxdd_

PDB Entry: 1xxd, 2.91 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with mutated ecotin

PDB Compounds: (D:) ecotin

SCOPe Domain Sequences for d1xxdd_:

Sequence, based on SEQRES records:

>d1xxdd_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1xxdd_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvssndftrvvckekkfvtaylgdagmlrynsklpivvytpdnvdvkyr
vwkaeekidnavvr

Timeline for d1xxdd_:

• d1xxdd_ first appeared in SCOP 1.71
  
• d1xxdd_ appears in SCOPe 2.06
  
• d1xxdd_ appears in the current release, SCOPe 2.08