Lineage for d1xxdd_ (1xxd D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039048Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2039049Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2039050Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 protein domains)
  6. 2039051Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 2039052Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. 2039077Domain d1xxdd_: 1xxd D: [116156]
    Other proteins in same PDB: d1xxda_, d1xxdb_

Details for d1xxdd_

PDB Entry: 1xxd (more details), 2.91 Å

PDB Description: Crystal Structure of the FXIa Catalytic Domain in Complex with mutated Ecotin
PDB Compounds: (D:) ecotin

SCOPe Domain Sequences for d1xxdd_:

Sequence, based on SEQRES records: (download)

>d1xxdd_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1xxdd_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvssndftrvvckekkfvtaylgdagmlrynsklpivvytpdnvdvkyr
vwkaeekidnavvr

SCOPe Domain Coordinates for d1xxdd_:

Click to download the PDB-style file with coordinates for d1xxdd_.
(The format of our PDB-style files is described here.)

Timeline for d1xxdd_: