![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
![]() | Protein Ecotin, trypsin inhibitor [49774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
![]() | Domain d1xxdc_: 1xxd C: [116155] Other proteins in same PDB: d1xxda_, d1xxdb_ |
PDB Entry: 1xxd (more details), 2.91 Å
SCOPe Domain Sequences for d1xxdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxdc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle gwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv kyrvwkaeekidnavvr
Timeline for d1xxdc_: