SCOPe 2.06: Domain d1xxdc_: 1xxd C:

Lineage for d1xxdc_ (1xxd C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1xxdc_: 1xxd C: [116155]
   Other proteins in same PDB: d1xxda_, d1xxdb_

Details for d1xxdc_

PDB Entry: 1xxd, 2.91 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with mutated ecotin

PDB Compounds: (C:) ecotin

SCOPe Domain Sequences for d1xxdc_:

Sequence; same for both SEQRES and ATOM records:

>d1xxdc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr

Timeline for d1xxdc_:

• d1xxdc_ first appeared in SCOP 1.71
  
• d1xxdc_ appears in SCOPe 2.05
  
• d1xxdc_ appears in SCOPe 2.07
  
• d1xxdc_ appears in the current release, SCOPe 2.08