Lineage for d1xxdc_ (1xxd C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)
  6. Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. Domain d1xxdc_: 1xxd C: [116155]
    Other proteins in same PDB: d1xxda_, d1xxdb_

Details for d1xxdc_

PDB Entry: 1xxd (more details), 2.91 Å

PDB Description: Crystal Structure of the FXIa Catalytic Domain in Complex with mutated Ecotin
PDB Compounds: (C:) ecotin

SCOPe Domain Sequences for d1xxdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxdc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr

SCOPe Domain Coordinates for d1xxdc_ are not available.

Timeline for d1xxdc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xxda_, d1xxdb_, d1xxdd_