Lineage for d1xxdb_ (1xxd B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545860Protein Coagulation factor XI [117237] (1 species)
  7. 1545861Species Human (Homo sapiens) [TaxId:9606] [117238] (27 PDB entries)
    Uniprot P03951 388-624
  8. 1545891Domain d1xxdb_: 1xxd B: [116154]
    Other proteins in same PDB: d1xxdc_, d1xxdd_

Details for d1xxdb_

PDB Entry: 1xxd (more details), 2.91 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with mutated ecotin
PDB Compounds: (B:) Coagulation factor XI

SCOPe Domain Sequences for d1xxdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxdb_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d1xxdb_:

Click to download the PDB-style file with coordinates for d1xxdb_.
(The format of our PDB-style files is described here.)

Timeline for d1xxdb_: