Lineage for d1xxda_ (1xxd A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670593Protein Coagulation factor XI [117237] (1 species)
  7. 670594Species Human (Homo sapiens) [TaxId:9606] [117238] (3 PDB entries)
  8. 670599Domain d1xxda_: 1xxd A: [116153]
    Other proteins in same PDB: d1xxdc_, d1xxdd_

Details for d1xxda_

PDB Entry: 1xxd (more details), 2.91 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with mutated ecotin
PDB Compounds: (A:) Coagulation factor XI

SCOP Domain Sequences for d1xxda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxda_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOP Domain Coordinates for d1xxda_:

Click to download the PDB-style file with coordinates for d1xxda_.
(The format of our PDB-style files is described here.)

Timeline for d1xxda_: