Lineage for d1xx9d_ (1xx9 D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)
  6. Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. Domain d1xx9d_: 1xx9 D: [116152]
    Other proteins in same PDB: d1xx9a_, d1xx9b_
    complexed with nag

Details for d1xx9d_

PDB Entry: 1xx9 (more details), 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r
PDB Compounds: (D:) ecotin

SCOPe Domain Sequences for d1xx9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx9d_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt
legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv
dvkyrvwkaeekidnavvr

SCOPe Domain Coordinates for d1xx9d_ are not available.

Timeline for d1xx9d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xx9a_, d1xx9b_, d1xx9c_