SCOP 1.73: Domain d1xx9b_: 1xx9 B:

Lineage for d1xx9b_ (1xx9 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Coagulation factor XI [117237] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117238] (3 PDB entries)

8. Domain d1xx9b_: 1xx9 B: [116150]
   Other proteins in same PDB: d1xx9c_, d1xx9d_
   complexed with nag; mutant

Details for d1xx9b_

PDB Entry: 1xx9, 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r

PDB Compounds: (B:) Coagulation factor XI

SCOP Domain Sequences for d1xx9b_:

Sequence, based on SEQRES records:

>d1xx9b_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

Sequence, based on observed residues (ATOM records):

>d1xx9b_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgyt
dcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreggkdack
gdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

Timeline for d1xx9b_:

• d1xx9b_ first appeared in SCOP 1.71
  
• d1xx9b_ appears in SCOP 1.75
  
• d1xx9b_ appears in the current release, SCOPe 2.08