Lineage for d1xx9b_ (1xx9 B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670593Protein Coagulation factor XI [117237] (1 species)
  7. 670594Species Human (Homo sapiens) [TaxId:9606] [117238] (3 PDB entries)
  8. 670596Domain d1xx9b_: 1xx9 B: [116150]
    Other proteins in same PDB: d1xx9c_, d1xx9d_
    complexed with nag; mutant

Details for d1xx9b_

PDB Entry: 1xx9 (more details), 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r
PDB Compounds: (B:) Coagulation factor XI

SCOP Domain Sequences for d1xx9b_:

Sequence, based on SEQRES records: (download)

>d1xx9b_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

Sequence, based on observed residues (ATOM records): (download)

>d1xx9b_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgyt
dcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreggkdack
gdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOP Domain Coordinates for d1xx9b_:

Click to download the PDB-style file with coordinates for d1xx9b_.
(The format of our PDB-style files is described here.)

Timeline for d1xx9b_: