SCOP 1.73: Domain d1xx7f_: 1xx7 F:

Lineage for d1xx7f_ (1xx7 F:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.1: HD domain [101340] (6 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Oxetanocin-like protein PF0395 [116971] (1 species)
   similar fold and oligomeric structure to 5'-nucleotidase YfbR

7. Species Pyrococcus furiosus [TaxId:2261] [116972] (1 PDB entry)

8. Domain d1xx7f_: 1xx7 F: [116148]
   Structural genomics target
   complexed with ni, unx

Details for d1xx7f_

PDB Entry: 1xx7, 2.26 Å

PDB Description: conserved hypothetical protein from pyrococcus furiosus pfu-403030-001

PDB Compounds: (F:) oxetanocin-like protein

SCOP Domain Sequences for d1xx7f_:

Sequence, based on SEQRES records:

>d1xx7f_ a.211.1.1 (F:) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]}
sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
kiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl

Sequence, based on observed residues (ATOM records):

>d1xx7f_ a.211.1.1 (F:) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]}
sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
kiadkldmiiqayeyelsgaknlsefwnalisrylreiieevrrl

Timeline for d1xx7f_:

• d1xx7f_ first appeared in SCOP 1.71
  
• d1xx7f_ appears in SCOP 1.75
  
• d1xx7f_ appears in the current release, SCOPe 2.08, called d1xx7f1