Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.1: HD domain [101340] (14 proteins) Pfam PF01966; metal dependent phosphohydrolases |
Protein Oxetanocin-like protein PF0395 [116971] (1 species) similar fold and oligomeric structure to 5'-nucleotidase YfbR |
Species Pyrococcus furiosus [TaxId:2261] [116972] (1 PDB entry) Uniprot Q8U3R1 |
Domain d1xx7d1: 1xx7 D:2-171 [116146] Other proteins in same PDB: d1xx7a2, d1xx7b2, d1xx7c2, d1xx7d2, d1xx7e2, d1xx7f2 Structural genomics target complexed with ni, unx |
PDB Entry: 1xx7 (more details), 2.26 Å
SCOPe Domain Sequences for d1xx7d1:
Sequence, based on SEQRES records: (download)
>d1xx7d1 a.211.1.1 (D:2-171) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]} idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk iadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrr
>d1xx7d1 a.211.1.1 (D:2-171) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]} idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk iadkldmiiqayeyelsgaknlsefeisrylreiieevrr
Timeline for d1xx7d1: