| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
| Family a.211.1.1: HD domain [101340] (14 proteins) Pfam PF01966; metal dependent phosphohydrolases |
| Protein Oxetanocin-like protein PF0395 [116971] (1 species) similar fold and oligomeric structure to 5'-nucleotidase YfbR |
| Species Pyrococcus furiosus [TaxId:2261] [116972] (1 PDB entry) Uniprot Q8U3R1 |
| Domain d1xx7a_: 1xx7 A: [116143] Structural genomics target complexed with ni, unx |
PDB Entry: 1xx7 (more details), 2.26 Å
SCOPe Domain Sequences for d1xx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx7a_ a.211.1.1 (A:) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]}
sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
kiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
Timeline for d1xx7a_: