Lineage for d1xx6b1 (1xx6 B:2-142)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871486Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 2871487Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. 2871488Species Clostridium acetobutylicum [TaxId:1488] [117562] (1 PDB entry)
    Uniprot Q97F65
  8. 2871490Domain d1xx6b1: 1xx6 B:2-142 [116141]
    Other proteins in same PDB: d1xx6a2, d1xx6b2
    Structural genomics target
    complexed with adp, zn

Details for d1xx6b1

PDB Entry: 1xx6 (more details), 2 Å

PDB Description: X-ray structure of Clostridium acetobutylicum thymidine kinase with ADP. Northeast Structural Genomics Target CAR26.
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1xx6b1:

Sequence, based on SEQRES records: (download)

>d1xx6b1 c.37.1.24 (B:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeidnryskedvvshmge
keqavaiknsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdfr
gkpfgpipelmaiaefvdkiq

Sequence, based on observed residues (ATOM records): (download)

>d1xx6b1 c.37.1.24 (B:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeavaiknsreilkyfee
dteviaidevqffddeiveivnkiaesgrrvicagldmdfrgkpfgpipelmaiaefvdk
iq

SCOPe Domain Coordinates for d1xx6b1:

Click to download the PDB-style file with coordinates for d1xx6b1.
(The format of our PDB-style files is described here.)

Timeline for d1xx6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xx6b2