Lineage for d1xx4a_ (1xx4 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577845Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 577846Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 577900Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 577937Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (3 species)
  7. 577951Species Rat (Rattus norvegicus), mitochondrial [TaxId:10116] [117465] (1 PDB entry)
  8. 577952Domain d1xx4a_: 1xx4 A: [116138]
    complexed with bam, po4, zn

Details for d1xx4a_

PDB Entry: 1xx4 (more details), 2.2 Å

PDB Description: Crystal Structure of Rat Mitochondrial 3,2-Enoyl-CoA

SCOP Domain Sequences for d1xx4a_:

Sequence, based on SEQRES records: (download)

>d1xx4a_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus), mitochondrial}
fsnkrvlvekegeagiavmkfknppvnslslefltefvisleklendksirgviltserp
gifsagldlmemygrnpahyaeywkavqelwlrlylsnltlisaingaspaggclmaltc
dyrimadnskytiglnesllgivapfwlkdnyvntighraaeralqlgtlfppaealkvg
lvdevvpedqvhskarsvmakwftipdhsrqltksmmrkatadnlikqreadiqnftsfi
srdsiqkslhvyleklk

Sequence, based on observed residues (ATOM records): (download)

>d1xx4a_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus), mitochondrial}
fsnkrvlvekagiavmkfknppvnslslefltefvisleklendksirgviltserpgif
sagldlmemygrnpahyaeywkavqelwlrlylsnltlisaingaspaggclmaltcdyr
imadnskytiglnesllgivapfwlkdnyvntighraaeralqlgtlfppaealkvglvd
evvpedqvhskarsvmakwftipdhsrqltksmmrkatadnlikqreadiqnftsfisrd
siqkslhvyleklk

SCOP Domain Coordinates for d1xx4a_:

Click to download the PDB-style file with coordinates for d1xx4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xx4a_: