Lineage for d1xx4a_ (1xx4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099623Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (5 species)
  7. 2099642Species Norway rat (Rattus norvegicus), mitochondrial [TaxId:10116] [117465] (1 PDB entry)
    Uniprot P23965
  8. 2099643Domain d1xx4a_: 1xx4 A: [116138]
    complexed with bam, po4, zn

Details for d1xx4a_

PDB Entry: 1xx4 (more details), 2.2 Å

PDB Description: Crystal Structure of Rat Mitochondrial 3,2-Enoyl-CoA
PDB Compounds: (A:) 3,2-trans-enoyl-CoA isomerase, mitochondrial

SCOPe Domain Sequences for d1xx4a_:

Sequence, based on SEQRES records: (download)

>d1xx4a_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus), mitochondrial [TaxId: 10116]}
fsnkrvlvekegeagiavmkfknppvnslslefltefvisleklendksirgviltserp
gifsagldlmemygrnpahyaeywkavqelwlrlylsnltlisaingaspaggclmaltc
dyrimadnskytiglnesllgivapfwlkdnyvntighraaeralqlgtlfppaealkvg
lvdevvpedqvhskarsvmakwftipdhsrqltksmmrkatadnlikqreadiqnftsfi
srdsiqkslhvyleklk

Sequence, based on observed residues (ATOM records): (download)

>d1xx4a_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus), mitochondrial [TaxId: 10116]}
fsnkrvlvekagiavmkfknppvnslslefltefvisleklendksirgviltserpgif
sagldlmemygrnpahyaeywkavqelwlrlylsnltlisaingaspaggclmaltcdyr
imadnskytiglnesllgivapfwlkdnyvntighraaeralqlgtlfppaealkvglvd
evvpedqvhskarsvmakwftipdhsrqltksmmrkatadnlikqreadiqnftsfisrd
siqkslhvyleklk

SCOPe Domain Coordinates for d1xx4a_:

Click to download the PDB-style file with coordinates for d1xx4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xx4a_: