Lineage for d1xwvb_ (1xwv B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658989Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
  6. 658993Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 658994Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
  8. 658996Domain d1xwvb_: 1xwv B: [116135]
    complexed with pe3, xpe

Details for d1xwvb_

PDB Entry: 1xwv (more details), 1.83 Å

PDB Description: Structure of the house dust mite allergen Der f 2: Implications for function and molecular basis of IgE cross-reactivity
PDB Compounds: (B:) Der f II

SCOP Domain Sequences for d1xwvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwvb_ b.1.18.7 (B:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfmkcplvkgqqydakytwnvpkiapksenvvvtvklvgdngvlaca
iathakird

SCOP Domain Coordinates for d1xwvb_:

Click to download the PDB-style file with coordinates for d1xwvb_.
(The format of our PDB-style files is described here.)

Timeline for d1xwvb_: