![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.12: PhoU-like [109755] (1 family) ![]() duplication: consists of two sequence each repeats adopting this fold |
![]() | Family a.7.12.1: PhoU-like [109756] (3 proteins) Pfam PF01895 this is a repeat family; one repeat unit is 1vct A:9-107 found in domain |
![]() | Protein Phosphate transport system protein PhoU [116839] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [116841] (1 PDB entry) Uniprot Q818I8; 49% sequence identity |
![]() | Domain d1xwma_: 1xwm A: [116132] Structural genomics target |
PDB Entry: 1xwm (more details), 2.5 Å
SCOP Domain Sequences for d1xwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]} tfaddlaslhnkliemgrltevalqqaieafqtqnanlamavidgdgsidaleeevndfa lwliaaqqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplvlmy rlatdmvstaiaaydredaslaaqiadmdhrvdeqygemmasllavaktdaatlaqmnvl alvaryiertadhatniaehlvylvkgkhydf
Timeline for d1xwma_: