Lineage for d1xwma_ (1xwm A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534650Superfamily a.7.12: PhoU-like [109755] (1 family) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 534651Family a.7.12.1: PhoU-like [109756] (2 proteins)
    Pfam 01895
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 534652Protein Phosphate transport system protein PhoU [116839] (2 species)
  7. 534662Species Bacillus stearothermophilus [TaxId:1422] [116841] (1 PDB entry)
  8. 534663Domain d1xwma_: 1xwm A: [116132]
    Structural genomics target

Details for d1xwma_

PDB Entry: 1xwm (more details), 2.5 Å

PDB Description: The crystal structure of PhoU (phosphate uptake regulator), Structural genomics

SCOP Domain Sequences for d1xwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus}
tfaddlaslhnkliemgrltevalqqaieafqtqnanlamavidgdgsidaleeevndfa
lwliaaqqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplvlmy
rlatdmvstaiaaydredaslaaqiadmdhrvdeqygemmasllavaktdaatlaqmnvl
alvaryiertadhatniaehlvylvkgkhydf

SCOP Domain Coordinates for d1xwma_:

Click to download the PDB-style file with coordinates for d1xwma_.
(The format of our PDB-style files is described here.)

Timeline for d1xwma_: