Lineage for d1xwma_ (1xwm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696852Superfamily a.7.12: PhoU-like [109755] (2 families) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 2696853Family a.7.12.1: PhoU-like [109756] (3 proteins)
    Pfam PF01895
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 2696860Protein Phosphate transport system protein PhoU [116839] (2 species)
  7. 2696870Species Bacillus stearothermophilus [TaxId:1422] [116841] (1 PDB entry)
    Uniprot Q818I8; 49% sequence identity
  8. 2696871Domain d1xwma_: 1xwm A: [116132]
    Structural genomics target

Details for d1xwma_

PDB Entry: 1xwm (more details), 2.5 Å

PDB Description: The crystal structure of PhoU (phosphate uptake regulator), Structural genomics
PDB Compounds: (A:) phosphate uptake regulator

SCOPe Domain Sequences for d1xwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]}
tfaddlaslhnkliemgrltevalqqaieafqtqnanlamavidgdgsidaleeevndfa
lwliaaqqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplvlmy
rlatdmvstaiaaydredaslaaqiadmdhrvdeqygemmasllavaktdaatlaqmnvl
alvaryiertadhatniaehlvylvkgkhydf

SCOPe Domain Coordinates for d1xwma_:

Click to download the PDB-style file with coordinates for d1xwma_.
(The format of our PDB-style files is described here.)

Timeline for d1xwma_: