Lineage for d1xwka2 (1xwk A:1-84)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 833885Protein Class mu GST [81359] (3 species)
  7. 833893Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
    Uniprot P09488
    Uniprot P28161
    Uniprot P09488 ! Uniprot P28161
  8. 833907Domain d1xwka2: 1xwk A:1-84 [116127]
    Other proteins in same PDB: d1xwka1, d1xwkb1, d1xwkc1

Details for d1xwka2

PDB Entry: 1xwk (more details), 2.3 Å

PDB Description: 2.3 angstrom resolution crystal structure of human glutathione s- transferase m1a-1a complexed with glutathionyl-s-dinitrobenzene
PDB Compounds: (A:) Glutathione S-transferase Mu 1

SCOP Domain Sequences for d1xwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwka2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d1xwka2:

Click to download the PDB-style file with coordinates for d1xwka2.
(The format of our PDB-style files is described here.)

Timeline for d1xwka2: