| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class mu GST [81348] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries) Uniprot P09488 P28161 |
| Domain d1xwka1: 1xwk A:85-217 [116126] Other proteins in same PDB: d1xwka2, d1xwkb2, d1xwkc2 complexed with gdn |
PDB Entry: 1xwk (more details), 2.3 Å
SCOPe Domain Sequences for d1xwka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwka1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk
Timeline for d1xwka1:
View in 3DDomains from other chains: (mouse over for more information) d1xwkb1, d1xwkb2, d1xwkc1, d1xwkc2 |