Lineage for d1xwea1 (1xwe A:1512-1658)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.3: TIMP-like [50242] (4 families) 
Family b.40.3.3: Netrin-like domain (NTR/C345C module) [89320] (3 proteins)
Pfam PF01759
Protein Complement C5 domain [117188] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117189] (2 PDB entries)
Uniprot P01031 1530-1676 # structure of the C5a anaphylotoxin domain (679-751) is also known (47689)
Domain d1xwea1: 1xwe A:1512-1658 [116125]
Other proteins in same PDB: d1xwea2
Details for d1xwea1
PDB Entry: 1xwe (more details)
PDB Description: nmr structure of c345c (ntr) domain of c5 of complement
PDB Compounds: (A:) Complement C5SCOPe Domain Sequences for d1xwea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwea1 b.40.3.3 (A:1512-1658) Complement C5 domain {Human (Homo sapiens) [TaxId: 9606]}
adcgqmqeeldltisaetrkqtackpeiayaykvsitsitvenvfvkykatlldiyktge
avaekdseitfikkvtctnaelvkgrqylimgkealqikynasfryiypldsltwieywp
rdttcsscqaflanldefaediflngc
SCOPe Domain Coordinates for d1xwea1:
Click to download the PDB-style file with coordinates for d1xwea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xwea1:
- d1xwea1 first appeared in SCOP 1.71, called d1xwea_
- d1xwea1 appears in SCOPe 2.07
View in 3D
