Lineage for d1xwca_ (1xwc A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699045Protein Thioredoxin [52835] (12 species)
  7. 699111Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
  8. 699124Domain d1xwca_: 1xwc A: [116124]

Details for d1xwca_

PDB Entry: 1xwc (more details), 2.3 Å

PDB Description: Drosophila thioredoxin, reduced, P6522
PDB Compounds: (A:) thioredoxin

SCOP Domain Sequences for d1xwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwca_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOP Domain Coordinates for d1xwca_:

Click to download the PDB-style file with coordinates for d1xwca_.
(The format of our PDB-style files is described here.)

Timeline for d1xwca_: