| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (15 proteins) |
| Protein Thioredoxin [52835] (12 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries) |
| Domain d1xwca_: 1xwc A: [116124] |
PDB Entry: 1xwc (more details), 2.3 Å
SCOP Domain Sequences for d1xwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwca_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani
Timeline for d1xwca_: