SCOP 1.75: Domain d1xwbb_: 1xwb B:

Lineage for d1xwbb_ (1xwb B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
   Uniprot Q9V429

8. Domain d1xwbb_: 1xwb B: [116121]

Details for d1xwbb_

PDB Entry: 1xwb, 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P42212

PDB Compounds: (B:) thioredoxin

SCOP Domain Sequences for d1xwbb_:

Sequence; same for both SEQRES and ATOM records:

>d1xwbb_ c.47.1.1 (B:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

Timeline for d1xwbb_:

• d1xwbb_ first appeared in SCOP 1.71
  
• d1xwbb_ appears in SCOP 1.73
  
• d1xwbb_ appears in SCOPe 2.01
  
• d1xwbb_ appears in the current release, SCOPe 2.08