SCOPe 2.06: Domain d1xwba_: 1xwb A:

Lineage for d1xwba_ (1xwb A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
   Uniprot Q9V429

8. Domain d1xwba_: 1xwb A: [116120]
   complexed with cd

Details for d1xwba_

PDB Entry: 1xwb, 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P42212

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1xwba_:

Sequence; same for both SEQRES and ATOM records:

>d1xwba_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

Timeline for d1xwba_:

• d1xwba_ first appeared in SCOP 1.71
  
• d1xwba_ appears in SCOPe 2.05
  
• d1xwba_ appears in SCOPe 2.07
  
• d1xwba_ appears in the current release, SCOPe 2.08