Lineage for d1xwba_ (1xwb A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833463Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 833524Protein Thioredoxin [52835] (12 species)
  7. 833590Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
    Uniprot Q9V429
  8. 833595Domain d1xwba_: 1xwb A: [116120]

Details for d1xwba_

PDB Entry: 1xwb (more details), 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P42212
PDB Compounds: (A:) thioredoxin

SCOP Domain Sequences for d1xwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwba_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOP Domain Coordinates for d1xwba_:

Click to download the PDB-style file with coordinates for d1xwba_.
(The format of our PDB-style files is described here.)

Timeline for d1xwba_: