![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries) Uniprot Q9V429 |
![]() | Domain d1xwac_: 1xwa C: [116118] Other proteins in same PDB: d1xwaa2 complexed with cd, cl |
PDB Entry: 1xwa (more details), 2.2 Å
SCOPe Domain Sequences for d1xwac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwac_ c.47.1.1 (C:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv decediameynissmptfvflkngvkveefaganakrledvikani
Timeline for d1xwac_:
![]() Domains from other chains: (mouse over for more information) d1xwaa1, d1xwaa2, d1xwab_, d1xwad_ |