Lineage for d1xwab_ (1xwa B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876323Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
    Uniprot Q9V429
  8. 2876325Domain d1xwab_: 1xwa B: [116117]
    Other proteins in same PDB: d1xwaa2
    complexed with cd, cl

Details for d1xwab_

PDB Entry: 1xwa (more details), 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P41212
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d1xwab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwab_ c.47.1.1 (B:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOPe Domain Coordinates for d1xwab_:

Click to download the PDB-style file with coordinates for d1xwab_.
(The format of our PDB-style files is described here.)

Timeline for d1xwab_: