SCOP 1.75: Domain d1xw9d_: 1xw9 D:

Lineage for d1xw9d_ (1xw9 D:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
   Uniprot Q9V429

8. Domain d1xw9d_: 1xw9 D: [116115]

Details for d1xw9d_

PDB Entry: 1xw9, 2.3 Å

PDB Description: Drosophila thioredoxin, oxidized, P21

PDB Compounds: (D:) thioredoxin

SCOP Domain Sequences for d1xw9d_:

Sequence; same for both SEQRES and ATOM records:

>d1xw9d_ c.47.1.1 (D:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

Timeline for d1xw9d_:

• d1xw9d_ first appeared in SCOP 1.71
  
• d1xw9d_ appears in SCOP 1.73
  
• d1xw9d_ appears in SCOPe 2.01
  
• d1xw9d_ appears in the current release, SCOPe 2.08