SCOPe 2.05: Domain d1xw9c_: 1xw9 C:

Lineage for d1xw9c_ (1xw9 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
   Uniprot Q9V429

8. Domain d1xw9c_: 1xw9 C: [116114]

Details for d1xw9c_

PDB Entry: 1xw9, 2.3 Å

PDB Description: Drosophila thioredoxin, oxidized, P21

PDB Compounds: (C:) thioredoxin

SCOPe Domain Sequences for d1xw9c_:

Sequence; same for both SEQRES and ATOM records:

>d1xw9c_ c.47.1.1 (C:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

Timeline for d1xw9c_:

• d1xw9c_ first appeared in SCOP 1.71
  
• d1xw9c_ appears in SCOPe 2.04
  
• d1xw9c_ appears in SCOPe 2.06
  
• d1xw9c_ appears in the current release, SCOPe 2.08