Lineage for d1xw9b_ (1xw9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876323Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
    Uniprot Q9V429
  8. 2876334Domain d1xw9b_: 1xw9 B: [116113]

Details for d1xw9b_

PDB Entry: 1xw9 (more details), 2.3 Å

PDB Description: Drosophila thioredoxin, oxidized, P21
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d1xw9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw9b_ c.47.1.1 (B:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOPe Domain Coordinates for d1xw9b_:

Click to download the PDB-style file with coordinates for d1xw9b_.
(The format of our PDB-style files is described here.)

Timeline for d1xw9b_: