Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (16 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries) Uniprot Q9V429 |
Domain d1xw9a_: 1xw9 A: [116112] |
PDB Entry: 1xw9 (more details), 2.3 Å
SCOPe Domain Sequences for d1xw9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xw9a_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv decediameynissmptfvflkngvkveefaganakrledvikani
Timeline for d1xw9a_: