Lineage for d1xw9a_ (1xw9 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584502Family c.47.1.1: Thioltransferase [52834] (13 proteins)
  6. 584553Protein Thioredoxin [52835] (12 species)
  7. 584613Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
  8. 584622Domain d1xw9a_: 1xw9 A: [116112]

Details for d1xw9a_

PDB Entry: 1xw9 (more details), 2.3 Å

PDB Description: Drosophila thioredoxin, oxidized, P21

SCOP Domain Sequences for d1xw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw9a_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster)}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOP Domain Coordinates for d1xw9a_:

Click to download the PDB-style file with coordinates for d1xw9a_.
(The format of our PDB-style files is described here.)

Timeline for d1xw9a_: