Lineage for d1xw8a_ (1xw8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833746Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1833861Family c.6.2.5: LamB/YcsF-like [117449] (3 proteins)
    Pfam PF03746
  6. 1833868Protein Hypothetical protein YbgL [117450] (1 species)
  7. 1833869Species Escherichia coli [TaxId:562] [117451] (1 PDB entry)
    Uniprot P75746
  8. 1833870Domain d1xw8a_: 1xw8 A: [116111]

Details for d1xw8a_

PDB Entry: 1xw8 (more details), 2 Å

PDB Description: X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90.
PDB Compounds: (A:) UPF0271 protein ybgL

SCOPe Domain Sequences for d1xw8a_:

Sequence, based on SEQRES records: (download)

>d1xw8a_ c.6.2.5 (A:) Hypothetical protein YbgL {Escherichia coli [TaxId: 562]}
mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
pdrenfgrsamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqla
daiaravyacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgal
ieneeqalaqtlemvqhgrvksitgewatvaaqtvclhgdgehalafarrlrsafaekgi
vvaaleh

Sequence, based on observed residues (ATOM records): (download)

>d1xw8a_ c.6.2.5 (A:) Hypothetical protein YbgL {Escherichia coli [TaxId: 562]}
mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
psamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqladaiarav
yacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgeeqalaqtl
emvqhgrvksitgewatvaaqtvclhgdghalafarrlrsafivvaaleh

SCOPe Domain Coordinates for d1xw8a_:

Click to download the PDB-style file with coordinates for d1xw8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xw8a_: