Lineage for d1xw8a1 (1xw8 A:1-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850687Family c.6.2.5: LamB/YcsF-like [117449] (3 proteins)
    Pfam PF03746
  6. 2850694Protein Hypothetical protein YbgL [117450] (1 species)
  7. 2850695Species Escherichia coli [TaxId:562] [117451] (1 PDB entry)
    Uniprot P75746
  8. 2850696Domain d1xw8a1: 1xw8 A:1-244 [116111]
    Other proteins in same PDB: d1xw8a2

Details for d1xw8a1

PDB Entry: 1xw8 (more details), 2 Å

PDB Description: X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90.
PDB Compounds: (A:) UPF0271 protein ybgL

SCOPe Domain Sequences for d1xw8a1:

Sequence, based on SEQRES records: (download)

>d1xw8a1 c.6.2.5 (A:1-244) Hypothetical protein YbgL {Escherichia coli [TaxId: 562]}
mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
pdrenfgrsamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqla
daiaravyacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgal
ieneeqalaqtlemvqhgrvksitgewatvaaqtvclhgdgehalafarrlrsafaekgi
vvaa

Sequence, based on observed residues (ATOM records): (download)

>d1xw8a1 c.6.2.5 (A:1-244) Hypothetical protein YbgL {Escherichia coli [TaxId: 562]}
mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
psamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqladaiarav
yacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgeeqalaqtl
emvqhgrvksitgewatvaaqtvclhgdghalafarrlrsafivvaa

SCOPe Domain Coordinates for d1xw8a1:

Click to download the PDB-style file with coordinates for d1xw8a1.
(The format of our PDB-style files is described here.)

Timeline for d1xw8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xw8a2