SCOP 1.71: Domain d1xw6d2: 1xw6 D:1-84

Lineage for d1xw6d2 (1xw6 D:1-84)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (10 PDB entries)

8. Domain d1xw6d2: 1xw6 D:1-84 [116110]
   Other proteins in same PDB: d1xw6a1, d1xw6b1, d1xw6c1, d1xw6d1
   complexed with gsh

Details for d1xw6d2

PDB Entry: 1xw6, 1.9 Å

PDB Description: 1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione

SCOP Domain Sequences for d1xw6d2:

Sequence; same for both SEQRES and ATOM records:

>d1xw6d2 c.47.1.5 (D:1-84) Class mu GST {Human (Homo sapiens)}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

Timeline for d1xw6d2:

• d1xw6d2 is new in SCOP 1.71
  
• d1xw6d2 appears in SCOP 1.73
  
• d1xw6d2 appears in the current release, SCOPe 2.08