Lineage for d1xw6d1 (1xw6 D:85-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326216Protein Class mu GST [81348] (3 species)
  7. 2326224Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
    Uniprot P09488 P28161
  8. 2326233Domain d1xw6d1: 1xw6 D:85-217 [116109]
    Other proteins in same PDB: d1xw6a2, d1xw6b2, d1xw6c2, d1xw6d2
    complexed with gsh

Details for d1xw6d1

PDB Entry: 1xw6 (more details), 1.9 Å

PDB Description: 1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione
PDB Compounds: (D:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xw6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw6d1 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d1xw6d1:

Click to download the PDB-style file with coordinates for d1xw6d1.
(The format of our PDB-style files is described here.)

Timeline for d1xw6d1: