SCOP 1.73: Domain d1xw5b2: 1xw5 B:1-84

Lineage for d1xw5b2 (1xw5 B:1-84)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)

8. Domain d1xw5b2: 1xw5 B:1-84 [116102]
   Other proteins in same PDB: d1xw5a1, d1xw5b1
   complexed with gsh

Details for d1xw5b2

PDB Entry: 1xw5, 1.8 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18)complexed with glutathione, monoclinic crystal form

PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d1xw5b2:

Sequence; same for both SEQRES and ATOM records:

>d1xw5b2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d1xw5b2:

• d1xw5b2 first appeared in SCOP 1.71
  
• d1xw5b2 appears in SCOP 1.75
  
• d1xw5b2 appears in the current release, SCOPe 2.08