Lineage for d1xw5a2 (1xw5 A:1-84)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584855Protein Class mu GST [81359] (3 species)
  7. 584863Species Human (Homo sapiens) [TaxId:9606] [52867] (10 PDB entries)
  8. 584864Domain d1xw5a2: 1xw5 A:1-84 [116100]
    Other proteins in same PDB: d1xw5a1, d1xw5b1

Details for d1xw5a2

PDB Entry: 1xw5 (more details), 1.8 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18)complexed with glutathione, monoclinic crystal form
PDB Compounds: (A:)

SCOP Domain Sequences for d1xw5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw5a2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens)}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1xw5a2:

Click to download the PDB-style file with coordinates for d1xw5a2.
(The format of our PDB-style files is described here.)

Timeline for d1xw5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xw5a1