Lineage for d1xvqa1 (1xvq A:2-165)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877709Protein Thiol peroxidase Tpx [102452] (4 species)
  7. 2877726Species Mycobacterium tuberculosis [TaxId:1773] [117600] (2 PDB entries)
    Uniprot P66952
  8. 2877727Domain d1xvqa1: 1xvq A:2-165 [116094]
    Other proteins in same PDB: d1xvqa2
    complexed with nh4, yt3

Details for d1xvqa1

PDB Entry: 1xvq (more details), 1.75 Å

PDB Description: Crystal structure of thiol peroxidase from Mycobacterium tuberculosis
PDB Compounds: (A:) Thiol Peroxidase

SCOPe Domain Sequences for d1xvqa1:

Sequence, based on SEQRES records: (download)

>d1xvqa1 c.47.1.10 (A:2-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]}
aqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvca
tsvrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiad
gpmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga

Sequence, based on observed residues (ATOM records): (download)

>d1xvqa1 c.47.1.10 (A:2-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]}
aqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvca
tsvrtfderaaasgatvlcvskdlpfaqkrfcnvmpasafrdsfgedygvtiadgpmagl
laraivvigadgnvaytelvpeiaqepnyeaalaalga

SCOPe Domain Coordinates for d1xvqa1:

Click to download the PDB-style file with coordinates for d1xvqa1.
(The format of our PDB-style files is described here.)

Timeline for d1xvqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xvqa2