![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Thiol peroxidase Tpx [102452] (4 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [117600] (2 PDB entries) Uniprot P66952 |
![]() | Domain d1xvqa1: 1xvq A:2-165 [116094] Other proteins in same PDB: d1xvqa2 complexed with nh4, yt3 |
PDB Entry: 1xvq (more details), 1.75 Å
SCOPe Domain Sequences for d1xvqa1:
Sequence, based on SEQRES records: (download)
>d1xvqa1 c.47.1.10 (A:2-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} aqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvca tsvrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiad gpmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga
>d1xvqa1 c.47.1.10 (A:2-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} aqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvca tsvrtfderaaasgatvlcvskdlpfaqkrfcnvmpasafrdsfgedygvtiadgpmagl laraivvigadgnvaytelvpeiaqepnyeaalaalga
Timeline for d1xvqa1: