Lineage for d1xvpd_ (1xvp D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008834Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 2008835Species Human (Homo sapiens) [TaxId:9606] [117016] (2 PDB entries)
    Uniprot Q14994 103-352
  8. 2008837Domain d1xvpd_: 1xvp D: [116093]
    Other proteins in same PDB: d1xvpa_, d1xvpc_
    complexed with cid, f15

Details for d1xvpd_

PDB Entry: 1xvp (more details), 2.6 Å

PDB Description: crystal structure of CAR/RXR heterodimer bound with SRC1 peptide, fatty acid and CITCO
PDB Compounds: (D:) Orphan nuclear receptor NR1I3

SCOPe Domain Sequences for d1xvpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvpd_ a.123.1.1 (D:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]}
pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
lqeics

SCOPe Domain Coordinates for d1xvpd_:

Click to download the PDB-style file with coordinates for d1xvpd_.
(The format of our PDB-style files is described here.)

Timeline for d1xvpd_: