SCOPe 2.01: Domain d1xvpc_: 1xvp C:

Lineage for d1xvpc_ (1xvp C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48511] (32 PDB entries)
   Uniprot P19793 227-458

8. Domain d1xvpc_: 1xvp C: [116092]
   Other proteins in same PDB: d1xvpb_, d1xvpd_
   complexed with cid, f15

Details for d1xvpc_

PDB Entry: 1xvp, 2.6 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid and citco

PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1xvpc_:

Sequence; same for both SEQRES and ATOM records:

>d1xvpc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt

Timeline for d1xvpc_:

• d1xvpc_ first appeared in SCOP 1.71
  
• d1xvpc_ appears in SCOP 1.75
  
• d1xvpc_ appears in SCOPe 2.02
  
• d1xvpc_ appears in the current release, SCOPe 2.08