Lineage for d1xvpc_ (1xvp C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009236Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2009237Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries)
    Uniprot P19793 227-458
  8. 2009272Domain d1xvpc_: 1xvp C: [116092]
    Other proteins in same PDB: d1xvpb_, d1xvpd_
    complexed with cid, f15

Details for d1xvpc_

PDB Entry: 1xvp (more details), 2.6 Å

PDB Description: crystal structure of CAR/RXR heterodimer bound with SRC1 peptide, fatty acid and CITCO
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1xvpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvpc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt

SCOPe Domain Coordinates for d1xvpc_:

Click to download the PDB-style file with coordinates for d1xvpc_.
(The format of our PDB-style files is described here.)

Timeline for d1xvpc_: