SCOPe 2.06: Domain d1xvpb_: 1xvp B:

Lineage for d1xvpb_ (1xvp B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117016] (2 PDB entries)
   Uniprot Q14994 103-352

8. Domain d1xvpb_: 1xvp B: [116091]
   Other proteins in same PDB: d1xvpa_, d1xvpc_
   complexed with cid, f15

Details for d1xvpb_

PDB Entry: 1xvp, 2.6 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid and citco

PDB Compounds: (B:) Orphan nuclear receptor NR1I3

SCOPe Domain Sequences for d1xvpb_:

Sequence; same for both SEQRES and ATOM records:

>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]}
pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
lqeics

Timeline for d1xvpb_:

• d1xvpb_ first appeared in SCOP 1.71
  
• d1xvpb_ appears in SCOPe 2.05
  
• d1xvpb_ appears in SCOPe 2.07
  
• d1xvpb_ appears in the current release, SCOPe 2.08