Lineage for d1xvpb_ (1xvp B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923576Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 923577Species Human (Homo sapiens) [TaxId:9606] [117016] (2 PDB entries)
    Uniprot Q14994 103-352
  8. 923578Domain d1xvpb_: 1xvp B: [116091]
    Other proteins in same PDB: d1xvpa_, d1xvpc_
    complexed with cid, f15

Details for d1xvpb_

PDB Entry: 1xvp (more details), 2.6 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid and citco
PDB Compounds: (B:) Orphan nuclear receptor NR1I3

SCOPe Domain Sequences for d1xvpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]}
pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
lqeics

SCOPe Domain Coordinates for d1xvpb_:

Click to download the PDB-style file with coordinates for d1xvpb_.
(The format of our PDB-style files is described here.)

Timeline for d1xvpb_: