Lineage for d1xvpb_ (1xvp B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543539Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 543540Species Human (Homo sapiens) [TaxId:9606] [117016] (2 PDB entries)
  8. 543541Domain d1xvpb_: 1xvp B: [116091]
    Other proteins in same PDB: d1xvpa_, d1xvpc_

Details for d1xvpb_

PDB Entry: 1xvp (more details), 2.6 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid and citco

SCOP Domain Sequences for d1xvpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens)}
pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
lqeics

SCOP Domain Coordinates for d1xvpb_:

Click to download the PDB-style file with coordinates for d1xvpb_.
(The format of our PDB-style files is described here.)

Timeline for d1xvpb_: