Lineage for d1xvpa_ (1xvp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729497Domain d1xvpa_: 1xvp A: [116090]
    Other proteins in same PDB: d1xvpb_, d1xvpd_
    complexed with cid, f15

Details for d1xvpa_

PDB Entry: 1xvp (more details), 2.6 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid and citco
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1xvpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvpa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1xvpa_:

Click to download the PDB-style file with coordinates for d1xvpa_.
(The format of our PDB-style files is described here.)

Timeline for d1xvpa_: